DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Magee1

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001073360.1 Gene:Magee1 / 317232 RGDID:1560259 Length:933 Species:Rattus norvegicus


Alignment Length:208 Identity:50/208 - (24%)
Similarity:92/208 - (44%) Gaps:26/208 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 QPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELKKRLPLVTNLLAE----TFGIIL 81
            :|.|.::..|..:|.::|.....|.|||:.::....  ..|.:.:.|.:....|.    .|...|
  Rat   462 KPQDPMEQNVAELLQFLLLKDQTKYPIKESEMREFI--VQEYRNQFPEILRRAAAHLECIFRFEL 524

  Fly    82 TPLDATTKTFICTAEEPVASIHELTPA---------QRPQFTLLYIILMYIFLRGNRIEDSKLYV 137
            ..||....|:|.        :::|.|.         ..|:..||.:||..|||.||:..::.::.
  Rat   525 KELDPEEHTYIL--------LNKLGPVPFEGLEDIPNGPKMGLLMMILGQIFLNGNQAREADIWE 581

  Fly   138 MLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQ 202
            ||....:..:.....|| |.::.:...||.|:||  :...::.....:..|.||||:..|.|..:
  Rat   582 MLWRFGVQRERRLSVFG-NPKRLLSVEFVWQRYL--DYRPITDCVPVEYEFYWGPRSHVETTKMK 643

  Fly   203 MVQFASKLLNQHP 215
            :::|.:::.|:.|
  Rat   644 ILKFMARIYNKDP 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 43/177 (24%)
Magee1NP_001073360.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..113
PHA03249 36..>176 CDD:223023
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 149..236
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 256..282
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..393
MAGE 474..642 CDD:279759 44/180 (24%)
Interaction with DTNA. /evidence=ECO:0000250 719..933
MAGE 728..888 CDD:279759
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345485
Domainoid 1 1.000 55 1.000 Domainoid score I10828
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44556
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.810

Return to query results.
Submit another query.