DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Nsmce3

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001166998.1 Gene:Nsmce3 / 309259 RGDID:1309206 Length:278 Species:Rattus norvegicus


Alignment Length:217 Identity:71/217 - (32%)
Similarity:115/217 - (52%) Gaps:13/217 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SRAARSQNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIA-VAGDKSEL-KKRLP 67
            |||:.|...:..:..:|    ::.||..::.::|....:|||||..|::. |.||..:: ...|.
  Rat    42 SRASLSAPTVGPRTQKQ----LELKVAELVQFLLIKDQKKIPIKRTDILKHVVGDYRDVYPNLLK 102

  Fly    68 LVTNLLAETFGIILTPLDATTKTFI-CTAEEPVASIHELTPAQ-RPQFTLLYIILMYIFLRGNRI 130
            |....|...||..|..|:..:.|:| ..|.|||....|:...| .|...||.|:|..||::||.|
  Rat   103 LAAERLQYVFGYKLVELEPKSHTYILINALEPVEEDAEVRGDQGTPTSGLLMIVLGLIFMKGNTI 167

  Fly   131 EDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFL-WGPRA 194
            .:::::..|..|.:||.::|..|| :.:|.|.|.||:|:||:..|   ..:.|...:.| ||||.
  Rat   168 TETEVWDFLRRLGVYPTKKHLIFG-DPKKLITEDFVRQRYLEYRR---IPHTDPVDYELQWGPRT 228

  Fly   195 KAEFTFEQMVQFASKLLNQHPK 216
            ..|.:..::::|.:|:.||.||
  Rat   229 NLETSKMKVLKFVAKVHNQDPK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 58/169 (34%)
Nsmce3NP_001166998.1 MAGE 66..235 CDD:279759 58/172 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.