DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Ndn

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001008558.2 Gene:Ndn / 308690 RGDID:1310526 Length:325 Species:Rattus norvegicus


Alignment Length:244 Identity:65/244 - (26%)
Similarity:114/244 - (46%) Gaps:28/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASTSRAARSQN---AIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLI-AVAGD-KSE 61
            |...||.:.|:   .||:..|  |..:|. |...::.|:|....:::.:...|:: .|.|. |..
  Rat    78 AEEGRAHQPQSPARPIPAPPA--PAQLVQ-KAHELMWYVLVKDQKRMVLWFPDMVKEVMGSYKKW 139

  Fly    62 LKKRLPLVTNLLAETFGIILTPLDATTKTFICTAEEPVASIHELTPAQ---------RPQFTLLY 117
            .:..|...:.:||..||:.|...:..|..|        |.:..|:|.:         .|...||.
  Rat   140 CRSILRRTSVILARVFGLHLRLTNLHTMEF--------ALVKALSPEELDRVALNNRMPMTGLLL 196

  Fly   118 IILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYD 182
            :||..|:::|....:..::.:|.:|.:.|.::|..|| ::||.|.|.||:|.|||.:|  :...:
  Rat   197 MILSLIYVKGRGAREGAVWNVLRILGLRPWKKHSTFG-DVRKIITEEFVQQNYLKYQR--VPHIE 258

  Fly   183 DSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVFGHHLSMAQEGVNA 231
            ..:..|.|||||..|.|..|:::|.:::..:.|:.:......|.|...|
  Rat   259 PPEYEFFWGPRANREITKMQIMEFLARVFKKDPQAWPSRYREALEQARA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 49/175 (28%)
NdnNP_001008558.2 MAGE 109..277 CDD:396164 49/178 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345483
Domainoid 1 1.000 55 1.000 Domainoid score I10828
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5077
OMA 1 1.010 - - QHG55398
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44556
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.870

Return to query results.
Submit another query.