DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and RGD1559726

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_225656.1 Gene:RGD1559726 / 307203 RGDID:1559726 Length:300 Species:Rattus norvegicus


Alignment Length:211 Identity:53/211 - (25%)
Similarity:98/211 - (46%) Gaps:32/211 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DVVDAKV-RAILNYILDHTAQKIPIKDKDLIAVAGDKSELKKRLPLV----TNLLAETFGIILTP 83
            |::::|| ..||..:|.:..::...|.:.|..|.....|   ..|::    ::.|..|||:.:..
  Rat    91 DMLNSKVIDLILFLLLKYRRKQQTCKAEILYMVIRGYEE---HFPVIFAKASDCLRLTFGLEIVE 152

  Fly    84 LDATTKTFICTAEEPVASIHEL----------TPAQRPQFTLLYIILMYIFLRGNRIEDSKLYVM 138
            .:....::        :.:|.|          .|.. |:..||.|:|..||:..|...:..|:.:
  Rat   153 RNPRVHSY--------SLVHALGLTYDVMQHGFPGV-PKIGLLIIVLCIIFIEDNCASEQVLWRI 208

  Fly   139 LEMLNIYPDEEHGYFG-PNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQ 202
            |..:.:|...:|..:| |.:  .|.|.||::.||  |..|::..|.....:||||||.||.|..:
  Rat   209 LNNVGLYAGRDHFVYGDPGV--LITEHFVQEGYL--ECRQVADSDPPTKEYLWGPRAHAETTKMK 269

  Fly   203 MVQFASKLLNQHPKVF 218
            :::|.:.::.|.|:.:
  Rat   270 LLKFFASIVKQDPRSY 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 45/179 (25%)
RGD1559726XP_225656.1 MAGE 130..268 CDD:279759 40/150 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 55 1.000 Domainoid score I10828
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5077
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44556
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.