DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Mageb1

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_008771508.1 Gene:Mageb1 / 302748 RGDID:1565746 Length:340 Species:Rattus norvegicus


Alignment Length:250 Identity:63/250 - (25%)
Similarity:104/250 - (41%) Gaps:48/250 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RSQNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSE------LKK--- 64
            ||.:..|.......:|::..|...::.|:|.....|.|::..:::.|...:.:      |||   
  Rat    89 RSFSRAPLATGSTQMDLMTRKTGMLMEYMLCKYKVKQPMRKGEMLKVINRRFKDHFPEILKKASY 153

  Fly    65 RLPLVTNLLAETFGIILTPLDATTKTFICTAEEPVASIHELTPAQR-------------PQFTLL 116
            ||.:|       ||:.|..:            :|....:||.....             |...:|
  Rat   154 RLDVV-------FGLELKEI------------QPHGQAYELVSKLEFQDDGSGSSELGLPTRGIL 199

  Fly   117 YIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAY 181
            ..:|..|:|......:.:::..|.||.:|....|..|| ::||.|.|..|::|||  :.||:...
  Rat   200 IPLLSVIYLNNYCAPEKEVWHFLNMLGVYDGISHLIFG-DIRKLITEDLVREQYL--QYSQVPNS 261

  Fly   182 DDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVFGHH----LSMAQEGVNAE 232
            |.....|||||||.||.:..:::.|.:|:....|.|:..|    |...:|...||
  Rat   262 DPPSYEFLWGPRAYAETSLVKVMDFLAKVSETMPGVYSSHYEQTLIEEEEKAQAE 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 49/186 (26%)
Mageb1XP_008771508.1 MAGE_N 5..88 CDD:289225
MAGE 113..277 CDD:279759 47/185 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.