DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Mageb5

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001100416.1 Gene:Mageb5 / 302442 RGDID:1563078 Length:366 Species:Rattus norvegicus


Alignment Length:200 Identity:56/200 - (28%)
Similarity:92/200 - (46%) Gaps:14/200 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDK-----SELKKRLPLVTNLLAETFGIILTPLD 85
            :|..|..:..|:|.....|..|..||||.|...|     :|:.||   ....:...||:.:..:|
  Rat   130 LDMYVAFVEQYVLYKFKMKQLIVRKDLINVIEPKYQYRFNEISKR---AFENIETVFGVSVIEID 191

  Fly    86 ATTKTFICTAEEPVASIHELTPAQ-RPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEE 149
            :|...:...:...:.:...:...: .|:..||..||..||::||.:.:..::..|..:.:||..:
  Rat   192 STNHIYDLVSNLKLPNKGRVCAGRGLPKTGLLMTILAMIFMKGNSVSEEDIWKFLNFMQVYPGRK 256

  Fly   150 HG-YFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQ 213
            |. |..|  ||.|.:.||:.:||  |..|:...|.....|.|||:|.||.|..::::|.:|....
  Rat   257 HFIYREP--RKLITQDFVRLKYL--EYGQIPNSDPPCYQFQWGPKAYAETTKMKVLEFMAKGSGV 317

  Fly   214 HPKVF 218
            .|..|
  Rat   318 EPSTF 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 50/171 (29%)
Mageb5NP_001100416.1 MAGE_N 5..>80 CDD:403589
MAGE 140..305 CDD:396164 50/171 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345496
Domainoid 1 1.000 55 1.000 Domainoid score I10828
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5077
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44556
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.860

Return to query results.
Submit another query.