DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Mageb6

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_017457675.1 Gene:Mageb6 / 302441 RGDID:1565662 Length:368 Species:Rattus norvegicus


Alignment Length:230 Identity:57/230 - (24%)
Similarity:116/230 - (50%) Gaps:25/230 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SQNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDK-----SELKKRLPLV 69
            |:.|...|.|::  |.:..|...::.::::....|.|....|::.|...|     :|:.:|:.:.
  Rat   118 SKVAAAIQSARR--DPLTRKANVLIEFMMEKFKVKEPFTQADMLRVINKKYKVHFTEILRRISVR 180

  Fly    70 TNLLAETFGIILTPLDATTKTFICTAEEPVASIHELTPAQ-RPQFTLLYIILMYIFLRGNRIEDS 133
            ..|:   ||:.|..:|.::::::...:..:::...|:.:. .|:..||..:|..||::||...:.
  Rat   181 LELV---FGLELKVVDPSSQSYMLVGKLGLSTEGSLSGSSGLPKTGLLMTLLGVIFMKGNHATEE 242

  Fly   134 KLYVMLEMLNIYPDEEHGYFG-PN---LRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRA 194
            :::..|:::.|||.:.|..|| |.   .:..:||.:|..|.:  ..|:..:|:     |.|||||
  Rat   243 EVWEFLKVVGIYPGKSHVIFGEPQEFITKDLVEENYVVYQQV--PGSEPPSYE-----FRWGPRA 300

  Fly   195 KAEFTFEQMVQFASKLLNQHPKVFGHHLSMAQEGV 229
            .||.|..::::..:|:.|..|..|   .||.:|.:
  Rat   301 YAETTKMKVLEVIAKINNTSPSFF---TSMYEEAM 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 44/174 (25%)
Mageb6XP_017457675.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.