DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and RGD1563590

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_006257076.4 Gene:RGD1563590 / 302435 RGDID:1563590 Length:342 Species:Rattus norvegicus


Alignment Length:240 Identity:57/240 - (23%)
Similarity:118/240 - (49%) Gaps:18/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASTSRAARSQNAIPSQEAQQPV---DVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELK 63
            :|.|..:..:.:.||.:..:|.   |:::.:|..:|.|:|.:...|.....::::.|...|.|  
  Rat    76 SSESDESSHEESEPSVQKDRPFLHQDLIERRVAILLQYLLHNYNLKQLTTKEEMLKVITKKYE-- 138

  Fly    64 KRLPLV----TNLLAETFGIILTPLDATTKTFICTAEEPVASIHELTPAQ-RPQFTLLYIILMYI 123
            |..|.:    :..|.:.|.:.:..:.::..::...::..:.:...:...: .|:...|..||..|
  Rat   139 KDFPEILRKASEKLEDAFAVEVREVSSSQPSYDLISKLKLPNNGRIRAGKGLPKTGFLMSILGII 203

  Fly   124 FLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFF 188
            |::||...:..::.:|:...|||.::|..|| ..||.:.:..||.:||  |..|::..|..:..|
  Rat   204 FIQGNSASEEDIWKILKKKRIYPGKKHRVFG-EPRKLMTQYLVKLKYL--EYRQVAHSDPPRYEF 265

  Fly   189 LWGPRAKAEFTFEQMVQFASKLLNQHPKVFGHHLS-MAQEGVNAE 232
            ||||:|.||.:..:::::.:|:....|    |.:| :.||.:..|
  Rat   266 LWGPQAHAETSKMKVLEYLAKINKTTP----HAISALYQEALKDE 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 42/169 (25%)
RGD1563590XP_006257076.4 MAGE 131..278 CDD:396164 39/151 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.