DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MGC114483

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001020051.1 Gene:MGC114483 / 302434 RGDID:1564443 Length:340 Species:Rattus norvegicus


Alignment Length:223 Identity:58/223 - (26%)
Similarity:104/223 - (46%) Gaps:22/223 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 QEAQQPVDVVDAKVRAILNYILD-HTAQKIPIKDKDLIAVAGD-KSELKKRLPLVTNLLAETFGI 79
            |.|::  |.:..|...:|:|:|: :...:.|::.:.|..::.. |....:.|...|..|...:|:
  Rat   100 QSARR--DPLTRKATKLLHYLLEKYQKDEQPVQAEMLKLISRKYKGHFPRILEKATYQLELVYGL 162

  Fly    80 ILTPLDATTKTFICTAEEPV---ASI---HELTPAQRPQFTLLYIILMYIFLRGNRIEDSKLYVM 138
            .|...:.||.::...::.|:   |::   .||     |:..|:..:|..||::.|...:.:::..
  Rat   163 ELKVDNPTTCSYALVSKLPIRPGANVGGKREL-----PKTGLILTLLGMIFMKDNHATEEEVWQF 222

  Fly   139 LEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQM 203
            |.|..|||...|..|| ..|..|.:..|.|.|:  |..|:...|.....|||||||..|.|..::
  Rat   223 LHMQGIYPGRRHLIFG-EPRNFITKELVDQNYV--EYRQVPGSDPPTYEFLWGPRAHEEHTSRKV 284

  Fly   204 VQFASKLLN----QHPKVFGHHLSMAQE 227
            ::..:|:.|    .:|:.:...||...|
  Rat   285 MEILTKIKNAIPTYYPRQYEEALSNQDE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 47/172 (27%)
MGC114483NP_001020051.1 MAGE_N 6..80 CDD:289225
MAGE 135..278 CDD:279759 41/150 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345493
Domainoid 1 1.000 55 1.000 Domainoid score I10828
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5077
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44556
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.860

Return to query results.
Submit another query.