DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Magea10

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_006229580.1 Gene:Magea10 / 293832 RGDID:1563693 Length:322 Species:Rattus norvegicus


Alignment Length:205 Identity:54/205 - (26%)
Similarity:96/205 - (46%) Gaps:24/205 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 VDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELKK----RLPLVTNLLAE----TFGIILT 82
            :|.||..::.|:|.....|.|:...:::      |.:.|    ..|::....:|    .||:.|.
  Rat   115 IDVKVDELVKYLLFKYLMKEPVSKAEIL------SNIIKNYQDHFPVIFREASECMQLVFGLELK 173

  Fly    83 PLDATTKTFICTAEEPVASIHELTPAQR-PQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYP 146
            .:|....|:|......:.....:|..|. |:..||.::|..||:.||.|.:..::.:|..:.:|.
  Rat   174 EIDPAGHTYILAIALELTYDGMMTDIQGIPKTGLLIMVLSIIFMEGNCIREDMVWGVLNNIGLYA 238

  Fly   147 DEEHGYFGPNLRKQIEETFVKQQYLKRER---SQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFAS 208
            ..||..:| ..||.|.:.||::.||:..:   |...:|:     |||||||.||.|..:::.|.:
  Rat   239 GSEHFIYG-EPRKLITDDFVQEGYLEYRQVPGSHPPSYE-----FLWGPRAYAETTKMKILTFLT 297

  Fly   209 KLLNQHPKVF 218
            .:....|:.:
  Rat   298 SINGSDPRSY 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 49/176 (28%)
Magea10XP_006229580.1 MAGE 122..290 CDD:279759 49/179 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345473
Domainoid 1 1.000 55 1.000 Domainoid score I10828
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5077
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 1 1.000 - - otm44556
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.