DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MAGEB18

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_775970.2 Gene:MAGEB18 / 286514 HGNCID:28515 Length:343 Species:Homo sapiens


Alignment Length:228 Identity:62/228 - (27%)
Similarity:111/228 - (48%) Gaps:20/228 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 STSRAARSQNAI---PSQEAQ-QPVDVVDAKVRAILNYILDHTAQKIPIKDKDLI--AVAGDKSE 61
            |::..|.||:..   .|:||: ...|.::.||.::::::|.....|.||...|:|  .:..||..
Human    80 SSNEGASSQDEKSLGSSREAEGWKEDPLNKKVVSLVHFLLQKYETKEPITKGDMIKFVIRKDKCH 144

  Fly    62 LKKRLPLVTNLLAETFGIILTPLD------ATTKTFICTAEEPVASIHELTPAQRPQFTLLYIIL 120
            ..:.|...:..:....|:.|..:|      |.......|.:|..:...::     |:..||.|.|
Human   145 FNEILKRASEHMELALGVDLKEVDPIRHYYAFFSKLDLTYDETTSDEEKI-----PKTGLLMIAL 204

  Fly   121 MYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSK 185
            ..|||.|||..:..::.::.|:.:|.|.:|..:| :.||.:.:..|:.:||  |..|:...|..:
Human   205 GVIFLNGNRAPEEAVWEIMNMMGVYADRKHFLYG-DPRKVMTKDLVQLKYL--EYQQVPNSDPPR 266

  Fly   186 TFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVF 218
            ..|||||||.||.:..::::|.:|:.:..|..|
Human   267 YEFLWGPRAHAETSKMKVLEFVAKIHDTVPSAF 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 48/172 (28%)
MAGEB18NP_775970.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..102 7/21 (33%)
MAGE_N 5..92 CDD:315167 4/11 (36%)
Interaction with LNX1. /evidence=ECO:0000269|PubMed:20864041 100..343 55/208 (26%)
MAGE 114..282 CDD:334545 48/175 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 313..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151970
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.