DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Mageb6b1

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001108150.1 Gene:Mageb6b1 / 278167 MGIID:3643982 Length:344 Species:Mus musculus


Alignment Length:206 Identity:55/206 - (26%)
Similarity:97/206 - (47%) Gaps:22/206 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DVVDAKVRAILNYILD-HTAQKIPIKDKDLIAVAGDKSELKKRLPLV----TNLLAETFGIILTP 83
            |.:..|...:|:|:|: :...:.|: :.:::.:.|.|  .|...|.:    |..|...:|:.|..
Mouse   109 DPLTRKASKVLHYLLEKYQKDEQPV-EGEMLKLIGRK--YKVHFPQILEKATYQLELVYGLELKV 170

  Fly    84 LDATTKTFICTAEEP------VASIHELTPAQRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEML 142
            .:..|.:::..::.|      |....||     |:..|:..||..||::|||..:.:::..|.|.
Mouse   171 DNPATHSYVLVSKLPILPGADVGGRREL-----PKTGLILTILGMIFMKGNRATEEEVWQFLHMQ 230

  Fly   143 NIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFA 207
            .|||...|..|| ..|..|.:..|:|.|:  |..|:...|.....|||||||..|.|:.:::...
Mouse   231 GIYPGRRHLIFG-EPRNFITKVLVEQNYV--EYRQVPGSDPPTHEFLWGPRAHEESTYRKVMDIL 292

  Fly   208 SKLLNQHPKVF 218
            :|:.:..|..:
Mouse   293 AKIKSAIPSYY 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 50/175 (29%)
Mageb6b1NP_001108150.1 MAGE_N 6..84 CDD:372109
MAGE 139..282 CDD:366651 45/152 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842093
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5107
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.860

Return to query results.
Submit another query.