DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Gm5071

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001242933.1 Gene:Gm5071 / 278087 MGIID:3645128 Length:344 Species:Mus musculus


Alignment Length:206 Identity:54/206 - (26%)
Similarity:97/206 - (47%) Gaps:22/206 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DVVDAKVRAILNYILD-HTAQKIPIKDKDLIAVAGDKSELKKRLPLV----TNLLAETFGIILTP 83
            |.:..|...:|:|:|: :...:.|: :.:::.:.|.|  .|...|.:    |..|...:|:.|..
Mouse   109 DPLTRKASKVLHYLLEKYQKDEQPV-EGEMLKLIGRK--YKVHFPQILEKATYQLELVYGLELKV 170

  Fly    84 LDATTKTFICTAEEP------VASIHELTPAQRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEML 142
            .:..|.:::..::.|      |....||     |:..|:..||..||::|||..:.:::..|.|.
Mouse   171 DNPATHSYVLVSKLPILPGADVGGRREL-----PKTGLILTILGMIFMKGNRATEEEVWQFLHMQ 230

  Fly   143 NIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFA 207
            .|||...|..|| ..|..|.:..|:|.|:  |..|:...|.....|||||||..:.|:.:::...
Mouse   231 GIYPGRRHLIFG-EPRNFITKVLVEQNYV--EYRQVPGSDPPTHEFLWGPRAHEKSTYRKVMDIL 292

  Fly   208 SKLLNQHPKVF 218
            :|:.:..|..:
Mouse   293 AKIKSAIPSYY 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 49/175 (28%)
Gm5071NP_001242933.1 MAGE_N 6..84 CDD:372109
MAGE 139..280 CDD:366651 44/150 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.