Sequence 1: | NP_649702.2 | Gene: | MAGE / 40860 | FlyBaseID: | FBgn0037481 | Length: | 232 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001242933.1 | Gene: | Gm5071 / 278087 | MGIID: | 3645128 | Length: | 344 | Species: | Mus musculus |
Alignment Length: | 206 | Identity: | 54/206 - (26%) |
---|---|---|---|
Similarity: | 97/206 - (47%) | Gaps: | 22/206 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 24 DVVDAKVRAILNYILD-HTAQKIPIKDKDLIAVAGDKSELKKRLPLV----TNLLAETFGIILTP 83
Fly 84 LDATTKTFICTAEEP------VASIHELTPAQRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEML 142
Fly 143 NIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFA 207
Fly 208 SKLLNQHPKVF 218 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
MAGE | NP_649702.2 | MAGE | 36..201 | CDD:279759 | 49/175 (28%) |
Gm5071 | NP_001242933.1 | MAGE_N | 6..84 | CDD:372109 | |
MAGE | 139..280 | CDD:366651 | 44/150 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1195799at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |