DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Magee2

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_444436.1 Gene:Magee2 / 272790 MGIID:2148316 Length:523 Species:Mus musculus


Alignment Length:202 Identity:47/202 - (23%)
Similarity:91/202 - (45%) Gaps:26/202 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSE-----LKKRLPLVTNLLAETFGIILTP 83
            |.::.|...::...:..|.:.:||...:|.|..|.:.:     :..|..|:.:|.   :|..|..
Mouse   309 DTMNDKANELVQLAIGVTEELLPIHQDELFANTGKEFQDVFPNILSRATLILDLF---YGFSLIE 370

  Fly    84 LDATTKTFICT----AEEPVASIHELTPAQRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNI 144
            :|.:...::..    :||....:..|   .||....|..||..|||.|||::::|::.:|:..::
Mouse   371 VDTSEHIYLLVPQPESEEEQVMLESL---GRPTQEYLMPILGLIFLMGNRVKEAKIWNLLQRFSV 432

  Fly   145 YPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASK 209
            ....:|.         |....::|:||  |...||..:..:...||||||..|.|..:.:::.::
Mouse   433 DVGRKHA---------ITCKLMRQRYL--ECRPLSYSNPVEYELLWGPRAHHEITKMKALEYMAR 486

  Fly   210 LLNQHPK 216
            ...:.|:
Mouse   487 FYGKQPQ 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 44/173 (25%)
Magee2NP_444436.1 MAGE 95..264 CDD:279759
MAGE 337..478 CDD:279759 41/157 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842082
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.810

Return to query results.
Submit another query.