DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MAGEA2B

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001308329.1 Gene:MAGEA2B / 266740 HGNCID:19340 Length:314 Species:Homo sapiens


Alignment Length:114 Identity:35/114 - (30%)
Similarity:57/114 - (50%) Gaps:11/114 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 PQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRER 175
            |:..||.|:|..|.:.|:...:.|::..|.||.::...|...|. :.||.:.:..|::.||  |.
Human   197 PKTGLLIIVLAIIAIEGDCAPEEKIWEELSMLEVFEGREDSVFA-HPRKLLMQDLVQENYL--EY 258

  Fly   176 SQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVFGH-HLS 223
            .|:...|.:...|||||||..|.::       .|:|:...|:.|. |:|
Human   259 RQVPGSDPACYEFLWGPRALIETSY-------VKVLHHTLKIGGEPHIS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 29/89 (33%)
MAGEA2BNP_001308329.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69
MAGE_N 5..94 CDD:403589
MAGE 116..280 CDD:396164 28/85 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151983
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.990

Return to query results.
Submit another query.