DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Gm4988

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001349815.1 Gene:Gm4988 / 245440 MGIID:3647289 Length:437 Species:Mus musculus


Alignment Length:208 Identity:58/208 - (27%)
Similarity:99/208 - (47%) Gaps:13/208 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELKKRLPLV----TNLLAETFGIILTPLDATTK 89
            ||..::|.::.....|.||...:::.|..:..|  ...|::    :..|...|||.:...||.:.
Mouse   227 KVTELVNLMILKYRIKEPINKVEMLRVVTEVFE--NEFPIIFEEASKCLEMIFGIDIKEGDAVSS 289

  Fly    90 TFICTAEEPVASIHELTPAQR-PQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYF 153
            :::.|....:......|.:|| |:...|.:||..||:.||...:..::..|.|:.||..:||..:
Mouse   290 SYVLTNSLGLTYDDVKTDSQRLPRNGFLIVILGVIFIEGNCASEESMWEFLNMMGIYDGKEHFIY 354

  Fly   154 GPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVF 218
            | ..|:.:....|.|.||..:  |:......:..|||||||.:|.|..::::|.:||.::.|..|
Mouse   355 G-EPREFLTGDLVYQNYLIYQ--QVPESYPPRYQFLWGPRAYSETTKMKVLEFLAKLTSRAPTYF 416

  Fly   219 GHHLSMA---QEG 228
            ....|.|   :||
Mouse   417 SSLYSEAFRDEEG 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 46/169 (27%)
Gm4988NP_001349815.1 MAGE 244..399 CDD:307557 45/159 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.