DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Magea10

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001078975.1 Gene:Magea10 / 236852 MGIID:3588211 Length:325 Species:Mus musculus


Alignment Length:236 Identity:59/236 - (25%)
Similarity:102/236 - (43%) Gaps:39/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RSQNAIPSQEAQQP-------------VDVVDAKVRAILNYILDHTAQKIPIKDKDLIA------ 54
            |||.:..|:....|             ...:|.||..::.|:|.....:.|:...::::      
Mouse    88 RSQVSADSEGEDSPGSSQALPCGTSLSTGEIDVKVDELVKYLLLKYLMQEPVSKAEILSNIIRNY 152

  Fly    55 ---VAGDKSELKKRLPLVTNLLAETFGIILTPLDATTKTFICTAEEPVASIHELTPAQR-PQFTL 115
               .|....|..:.:.||       ||:.|..:|..:.|:|.|....:.....:|..|. |:..|
Mouse   153 QDHFAVIFREALECMQLV-------FGLELKEIDPASHTYILTIALELTYDGMMTDVQGIPKTGL 210

  Fly   116 LYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRER---SQ 177
            |.::|..||:.||.:.:..::.:|..:.:|...||..:| ..||.|.:.||::.||:...   |.
Mouse   211 LIMVLSIIFMEGNCVSEDMVWSILNNIGLYAGNEHFIYG-EPRKLITDNFVQEGYLEYRHVPGSN 274

  Fly   178 LSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVF 218
            ...|:     |||||||.||.|..:::.|.:.:....|:.|
Mouse   275 PPFYE-----FLWGPRAYAETTKMKILTFLTSINGSDPRSF 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 48/177 (27%)
Magea10NP_001078975.1 MAGE_N <52..100 CDD:372109 4/11 (36%)
MAGE 138..293 CDD:366651 46/167 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5107
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.