DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Mageb18

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_776144.1 Gene:Mageb18 / 215641 MGIID:3045344 Length:327 Species:Mus musculus


Alignment Length:205 Identity:48/205 - (23%)
Similarity:97/205 - (47%) Gaps:21/205 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DVVDAKVRAILNYILDHTAQKIPIKDKDLI--AVAGDKSELKKRLPLVTNLLAETFGIILTPLDA 86
            |.::.||..::.::::...:|..|...|::  .:...|:...:.|...:..:...|||.|..:|.
Mouse    89 DPINHKVVLLVQFLMEKYQKKEVITKADMLKYVIKTSKNHFNEILKRASEHMELAFGIDLKEVDP 153

  Fly    87 TTKTFICTAEEPVASIHELT--------PAQRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLN 143
            ....:        |..::|.        ..:.|...||.|:|..||:..|.:.:::::.:|.|:.
Mouse   154 NRHCY--------ALFNKLEHTFDGVMGEEKMPSSGLLMIVLGVIFMNDNCVSETEIWNVLSMMG 210

  Fly   144 IYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFAS 208
            :|.:.:|..:| :.:|.|.|..|:.:||  |..|:...:.....|.|||||.||.:..::::|.:
Mouse   211 VYANRKHFIYG-DPKKVITEDMVQLKYL--EYQQVPNSNPPSFEFTWGPRACAEISKMKILEFWA 272

  Fly   209 KLLNQHPKVF 218
            |:.:..|..|
Mouse   273 KIHDTTPDSF 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 41/174 (24%)
Mageb18NP_776144.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..85
MAGE_N 5..77 CDD:289225
MAGE 98..265 CDD:279759 41/177 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842087
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5107
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.