DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Mageb11

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001094920.1 Gene:Mageb11 / 212952 MGIID:2684890 Length:330 Species:Mus musculus


Alignment Length:198 Identity:48/198 - (24%)
Similarity:93/198 - (46%) Gaps:6/198 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DVVDAKVRAILNYILDH--TAQKIPIKDKDLIAVAGDKSELKKRLPLVTNLLAETFGIILTPLDA 86
            |::..||..::..:|.:  |.|...|:|...:....:..:..:.|......||:.|.:.|..:::
Mouse    89 DILTQKVFVLVQILLKNYKTKQLTTIEDMMQVIDEEEMDDFPEILRKAAERLADVFAVELREVES 153

  Fly    87 TTKTFICTAEEPVASIHELTPAQR-PQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEH 150
            :.:.:...::..:.:...:...|. |:...|..:|..||:.||...:..::..|..:.||..::|
Mouse   154 SRRVYDLISKLKLPNNGRVRAGQGFPKTGFLMTVLGIIFMNGNCAGEEDIWRTLRSMGIYSGKKH 218

  Fly   151 GYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHP 215
            ..|| ..||.|.:.|||.:|:  |..|::.....:..|||||:|.||.....:::|.:|:....|
Mouse   219 QIFG-EPRKLITQNFVKLKYV--ECRQVANSKPPRYEFLWGPKAYAETNKMAILKFVAKVNEISP 280

  Fly   216 KVF 218
            ..|
Mouse   281 SYF 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 41/167 (25%)
Mageb11NP_001094920.1 MAGE_N 5..>43 CDD:372109
MAGE 128..262 CDD:366651 34/136 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842099
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5107
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.860

Return to query results.
Submit another query.