DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and mage-1

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_491018.2 Gene:mage-1 / 185532 WormBaseID:WBGene00018230 Length:253 Species:Caenorhabditis elegans


Alignment Length:130 Identity:33/130 - (25%)
Similarity:53/130 - (40%) Gaps:23/130 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LLYIILMYIFLR--------GNRIEDSKLYVMLEMLNIYPDE----EHGYF-----GPNLRKQIE 162
            ||..:|||:|:.        |...||...|:...| :.:.|.    :|..|     .||.|.:  
 Worm   110 LLKNVLMYVFVATKPQSKHPGVAQEDLMSYMEASM-STHSDRKLSLDHMEFLKKLIAPNARSE-- 171

  Fly   163 ETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVFGHHLSMAQE 227
              |:|:.||...:| ::..|:....:.|||.|:.......:||...:|....|::.......|.|
 Worm   172 --FIKKGYLAFTKS-VNENDEEVFRYEWGPAARQTVDPLALVQTFQQLTGMKPEMLKEQTERANE 233

  Fly   228  227
             Worm   234  233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 27/102 (26%)
mage-1NP_491018.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105159
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.