DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Ndn

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_035012.2 Gene:Ndn / 17984 MGIID:97290 Length:325 Species:Mus musculus


Alignment Length:244 Identity:64/244 - (26%)
Similarity:113/244 - (46%) Gaps:28/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASTSRAARSQN---AIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLI-AVAGD-KSE 61
            |...||.:.|:   .||:..|  |..:|. |...::.|:|....:::.:...|:: .|.|. |..
Mouse    78 AEEGRAHQPQSPARPIPAPPA--PAQLVQ-KAHELMWYVLVKDQKRMVLWFPDMVKEVMGSYKKW 139

  Fly    62 LKKRLPLVTNLLAETFGIILTPLDATTKTFICTAEEPVASIHELTPAQ---------RPQFTLLY 117
            .:..|...:.:||..||:.|...:..|..|        |.:..|:|.:         .|...||.
Mouse   140 CRSILRRTSVILARVFGLHLRLTNLHTMEF--------ALVKALSPEELDRVALNNRMPMTGLLL 196

  Fly   118 IILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYD 182
            :||..|:::|....:..::.:|.:|.:.|.::|..|| ::||.|.|.||:|.|||.:|  :...:
Mouse   197 MILSLIYVKGRGAREGAVWNVLRILGLRPWKKHSTFG-DVRKIITEEFVQQNYLKYQR--VPHIE 258

  Fly   183 DSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVFGHHLSMAQEGVNA 231
            ..:..|.||.||..|.|..|:::|.:::..:.|:.:......|.|...|
Mouse   259 PPEYEFFWGSRANREITKMQIMEFLARVFKKDPQAWPSRYREALEQARA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 48/175 (27%)
NdnNP_035012.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..96 6/17 (35%)
MAGE 109..277 CDD:396164 48/178 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842083
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5107
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55398
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.870

Return to query results.
Submit another query.