DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Ndn

DIOPT Version :10

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_035012.2 Gene:Ndn / 17984 MGIID:97290 Length:325 Species:Mus musculus


Alignment Length:49 Identity:13/49 - (26%)
Similarity:24/49 - (48%) Gaps:4/49 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 IKWDFVTDLFVLSILTSALIGQCSGWANSEWYL---IIFNMLALLTTIT 153
            ::| .|.:...:....:.::.|.|..|||.|.|   |..:.|.::|.:|
Mouse   202 VEW-LVKNETAVGCRVAVVMMQYSILANSYWLLVEGIYLHSLLVVTVLT 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 30..201 CDD:426270 13/49 (27%)
NdnNP_035012.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..96
MAGE 109..277 CDD:426270 13/49 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.