DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Mageb2

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_112448.1 Gene:Mageb2 / 17146 MGIID:105117 Length:330 Species:Mus musculus


Alignment Length:207 Identity:52/207 - (25%)
Similarity:101/207 - (48%) Gaps:11/207 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELKKRLPLV---TNLLAE-TFGIILTPL 84
            |.:..|...::.::||....|..:...:::||...|  .|::.|.:   |:...| .||:.|..:
Mouse   100 DPIMRKASVLIEFLLDKFKMKEAVTRSEMLAVVNKK--YKEQFPEILRRTSARLELVFGLELKEI 162

  Fly    85 DATTKTFICTAEEPVASIHELTPA-QRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDE 148
            |.:|.:::...:..:::...|:.. ..|:..||..:|..||::|||..:.:::..|..:.:|..:
Mouse   163 DPSTHSYLLVGKLGLSTEGSLSSNWGLPRTGLLMSVLGVIFMKGNRATEQEVWQFLHGVGVYAGK 227

  Fly   149 EHGYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQ 213
            :|..||.  .::.....|::.||  |..|:...|.....|||||||.||.|..::::..:|:...
Mouse   228 KHLIFGE--PEEFIRDVVRENYL--EYRQVPGSDPPSYEFLWGPRAHAETTKMKVLEVLAKVNGT 288

  Fly   214 HPKVFGHHLSMA 225
            .|..|.:...:|
Mouse   289 VPSAFPNLYQLA 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 46/169 (27%)
Mageb2NP_112448.1 MAGE_N 5..75 CDD:289225
MAGE 123..276 CDD:279759 43/158 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842090
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5107
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.860

Return to query results.
Submit another query.