DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MAGEB16

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001093391.1 Gene:MAGEB16 / 139604 HGNCID:21188 Length:324 Species:Homo sapiens


Alignment Length:244 Identity:67/244 - (27%)
Similarity:118/244 - (48%) Gaps:42/244 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 STSRAARSQNAIPSQEAQQ--------------PVDVVDAKVRAILNYILDHTAQKIPIKDKDL- 52
            :|:.::.|..|..:||.:.              |.|.:|.||..::|::|.....|.||...|: 
Human    76 TTTSSSESDEASSNQEEEDSPSSSEDTSDPRNVPADALDQKVAFLVNFMLHKCQMKKPITKADML 140

  Fly    53 -IAVAGDKSELKKRLPLVTNLLAETFGIILTPLDATTKTF------------ICTAEEPVASIHE 104
             |.:..|:|...:.|...:..|...||:.:..:|.||..:            :.:.|:.|     
Human   141 KIIIKDDESHFSEILLRASEHLEMIFGLDVVEVDPTTHCYGLFIKLGLTYDGMLSGEKGV----- 200

  Fly   105 LTPAQRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQ 169
                  |:..||.|:|..||::|||..:.:::.:|.:..:|..::|..|| ..|..|.:.|||::
Human   201 ------PKTGLLIIVLGVIFMKGNRATEEEVWEVLNLTGVYSGKKHFIFG-EPRMLITKDFVKEK 258

  Fly   170 YLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVF 218
            ||  |..|::..|.::..||||||||||.:..::::|.:|:...:|..|
Human   259 YL--EYQQVANSDPARYEFLWGPRAKAETSKMKVLEFVAKVHGSYPHSF 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 52/178 (29%)
MAGEB16NP_001093391.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
MAGE_N 5..90 CDD:315167 3/13 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..108 5/31 (16%)
MAGE 120..288 CDD:334545 53/181 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151980
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 1 1.000 - - oto88564
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.