DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MAGEB10

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_872312.2 Gene:MAGEB10 / 139422 HGNCID:25377 Length:347 Species:Homo sapiens


Alignment Length:242 Identity:63/242 - (26%)
Similarity:111/242 - (45%) Gaps:31/242 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 STSRAARSQNAIP----SQEAQQPV---DV----------VDAKVRAILNYILDHTAQKIPIKDK 50
            |||..|.|....|    .|..::|:   |:          ||.||..:::|:|.....|.||...
Human    71 STSATAASHTRHPEGVNDQMEERPICTQDLEATDSFPRGPVDEKVIILVHYLLYKYQMKEPITKA 135

  Fly    51 DLIAVAGDKSELKKRLPLVTNLLAE----TFGIILTPLDATTKTFICTAEEPV---ASIHELTPA 108
            |::......|  |.:.|::.:..:|    .||:.|..::.....::...:..:   |.:.:.|..
Human   136 DMLRNVTQMS--KSQFPVILSRASEHLELIFGLDLKEVEPNKHIYVLVNKLDLGCDAKLSDETGV 198

  Fly   109 QRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKR 173
              |:..||..:|..||..||.:.:.:::.:...:.:|...||..|| ..||.:.:..||:.||  
Human   199 --PKTGLLMTVLGIIFTNGNCVAEEEVWKVFNTMGLYDGIEHFMFG-EPRKLLTKDLVKENYL-- 258

  Fly   174 ERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVFGH 220
            |..|:...|..:..|||||||.||.:..::::|.:|:.:..|..|.:
Human   259 EYQQVPNSDPPRYQFLWGPRAHAETSKMKVLEFLAKVNDTAPSEFSN 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 46/171 (27%)
MAGEB10NP_872312.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
MAGE_N 5..93 CDD:315167 7/21 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 56..92 7/20 (35%)
MAGE 118..286 CDD:307557 46/174 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 328..347
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151960
Domainoid 1 1.000 63 1.000 Domainoid score I10231
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I5087
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.