DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and MAGEC3

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_619647.1 Gene:MAGEC3 / 139081 HGNCID:23798 Length:643 Species:Homo sapiens


Alignment Length:138 Identity:31/138 - (22%)
Similarity:63/138 - (45%) Gaps:12/138 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELKKRLPLVTNLLAE- 75
            :|:|..|: .|...:|.||..::.::|.....|.|:...:::.....|  .|...|::.....| 
Human   443 HALPESES-LPRYALDEKVAELVQFLLLKYQTKEPVTKAEMLTTVIKK--YKDYFPMIFGKAHEF 504

  Fly    76 ---TFGIILTPLDATTKTFICTAEEPVASIHE---LTPAQRPQFTLLYIILMYIFLRGNRIEDSK 134
               .|||.||.:|....::.  .|:.:...:|   :.....|:..||.:||..||::|:.:.:..
Human   505 IELIFGIALTDMDPDNHSYF--FEDTLDLTYEGSLIDDQGMPKNCLLILILSMIFIKGSCVPEEV 567

  Fly   135 LYVMLEML 142
            ::.:|..:
Human   568 IWEVLSAI 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 24/114 (21%)
MAGEC3NP_619647.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 347..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151974
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 1 1.000 - - FOG0000171
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.