DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Maged2

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001258038.1 Gene:Maged2 / 113947 RGDID:70899 Length:618 Species:Rattus norvegicus


Alignment Length:238 Identity:68/238 - (28%)
Similarity:112/238 - (47%) Gaps:31/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RAARSQNAIPSQEAQQP----VDVVDAKVRAILNYILDHTAQKIPIKDKDLIAVAGDKSELKKRL 66
            |||:.|:   |||.:.|    |.::..:...::.|:|.....||||:..|::     |..:|:..
  Rat   258 RAAKLQS---SQEPEAPPPRDVALLQGRANDLVKYLLAKDQTKIPIRRSDML-----KDIIKEYT 314

  Fly    67 PLVTNL-------LAETFGIILTPLDATTKTFI--CTAEEPVASIHELTPAQRPQFTLLYIILMY 122
            .:...:       |.:.|||.|..:|.....:|  .|.|...|.|.. |....|:..||.::|..
  Rat   315 DVYPEIIERAGYSLEKVFGIQLKEIDKNDHLYILLSTLEPTDAGILG-TTKDSPKLGLLMVLLSI 378

  Fly   123 IFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETFVKQQYLKRER---SQLSAYDDS 184
            ||:.|||..::.::.:|..|.:.|...|..|| :::|.|.:.||||:||...|   |....|:  
  Rat   379 IFMNGNRSSEAVIWEVLRKLGLRPGIHHSLFG-DVKKLITDEFVKQKYLDYARVPNSNPPEYE-- 440

  Fly   185 KTFFLWGPRAKAEFTFEQMVQFASKLLNQHPKVFGHHLSMAQE 227
               |.||.|:..|.:..::::||.|:..:.||.:......|.|
  Rat   441 ---FFWGLRSYYETSKMKVLKFACKVQKKDPKEWAAQYREAME 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 52/176 (30%)
Maged2NP_001258038.1 gliding_GltJ <32..>171 CDD:411345
MAGE 286..454 CDD:396164 52/179 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345486
Domainoid 1 1.000 55 1.000 Domainoid score I10828
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44556
orthoMCL 1 0.900 - - OOG6_105159
Panther 1 1.100 - - LDO PTHR11736
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.