DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Magee1

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_444431.3 Gene:Magee1 / 107528 MGIID:2148149 Length:918 Species:Mus musculus


Alignment Length:259 Identity:62/259 - (23%)
Similarity:108/259 - (41%) Gaps:59/259 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 STSRA---ARSQNAIPSQEAQ------------------------------QPVDVVDAKVRAIL 34
            |||||   |:..:..|.:|.:                              :|.|.::..|..:|
Mouse   403 STSRALQKAKDPSVRPKREDRFLDFQVLRDSKNSNSITIMGLGTSRVALTLKPQDPMEQNVAELL 467

  Fly    35 NYILDHTAQKIPIKDKDLIAVAGDKSELKKRLPLVTNLLAE----TFGIILTPLDATTKTFICTA 95
            .::|.....|.|||:.|:.... || :.:.:.|.:....|.    .|...|..||        |.
Mouse   468 QFLLLKDQTKYPIKESDMREFI-DK-DYRHQFPEILRRAAVHLECIFRFELKELD--------TE 522

  Fly    96 EEPVASIHELTPA---------QRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHG 151
            |.....:::|.|.         ..|:..||.:||.:|.|.||:..::.::.||....:..:....
Mouse   523 EHIYILLNKLGPVPFEGLEDVPNGPKMGLLMMILGHILLNGNQAREADIWEMLWRFGVQRERRLS 587

  Fly   152 YFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHP 215
            .|| |:::.:...||.|:||  :...|:.....:..|.||||::||.|..::::|.:|:.|:.|
Mouse   588 VFG-NVKRLLSVEFVWQRYL--DYRPLTDCVPVEYEFYWGPRSRAETTKMKILKFMAKIYNKDP 648

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 46/177 (26%)
Magee1NP_444431.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..140
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..227
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 367..388
MAGE 466..634 CDD:279759 47/180 (26%)
Interaction with DTNA. /evidence=ECO:0000269|PubMed:14623885 704..918
MAGE 713..873 CDD:279759
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842085
Domainoid 1 1.000 53 1.000 Domainoid score I11275
eggNOG 1 0.900 - - E1_KOG4562
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm42492
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11736
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.810

Return to query results.
Submit another query.