DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAGE and Tro

DIOPT Version :9

Sequence 1:NP_649702.2 Gene:MAGE / 40860 FlyBaseID:FBgn0037481 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_038956316.1 Gene:Tro / 100912141 RGDID:6488256 Length:1795 Species:Rattus norvegicus


Alignment Length:249 Identity:66/249 - (26%)
Similarity:107/249 - (42%) Gaps:54/249 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RAARSQNAIP-SQEAQQPVDV--VDAKVRAILNYILDHTAQKIPIKDKDLI-------------- 53
            |...:...|| |:....|.||  :..|...::.|:|.....|||||..|::              
  Rat   404 RTGNNYRRIPWSRRPPPPRDVAILQEKANKLVKYLLVKDQTKIPIKRSDMLKDVIQEYDEYFPEI 468

  Fly    54 --------------AVAGD---KSELKKRLPLVTNLLAETFGIILTPLDATTKTFI-CTAEEPVA 100
                          |..||   ...|.:|         :.|.:.|..:|..:..:| .:.:|..|
  Rat   469 LERASYALEKVKEGAALGDGRTGEALNRR---------KMFRVNLKEIDKQSSLYILISTQESSA 524

  Fly   101 SIHELTPAQRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEHGYFGPNLRKQIEETF 165
            .|.. |....|:..||.:||..||:.||:..::.::.:|..|.:.|...|..|| .:||.|.:.|
  Rat   525 GILG-TTKDTPKLGLLMVILSVIFMNGNKASEAVIWEVLRKLGLRPGVRHSLFG-EVRKLITDEF 587

  Fly   166 VKQQYLKRER---SQLSAYDDSKTFFLWGPRAKAEFTFEQMVQFASKLLNQHPK 216
            |||:||:.:|   |:...|:     |.||.|:..|.:..::::||.|:..:.||
  Rat   588 VKQKYLEYKRVPNSRPPEYE-----FFWGLRSYHETSKMKVLKFACKVQKKDPK 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAGENP_649702.2 MAGE 36..201 CDD:279759 53/199 (27%)
TroXP_038956316.1 MAGE 434..614 CDD:396164 51/195 (26%)
ser_rich_anae_1 <725..>1026 CDD:411418
ser_rich_anae_1 909..>1244 CDD:411418
ser_rich_anae_1 1171..>1513 CDD:411418
ser_rich_anae_1 1351..>1701 CDD:411418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1195799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.