DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sas-4 and Tcp10b

DIOPT Version :9

Sequence 1:NP_649701.2 Gene:Sas-4 / 40859 FlyBaseID:FBgn0011020 Length:901 Species:Drosophila melanogaster
Sequence 2:NP_033367.2 Gene:Tcp10b / 21462 MGIID:98542 Length:438 Species:Mus musculus


Alignment Length:464 Identity:123/464 - (26%)
Similarity:211/464 - (45%) Gaps:115/464 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   506 ERRKFEQQMRLQKSNANSKEKKEIAALKQEVEGLQLQLKQKEQAHVSAQARLRAQLRASEKEQRN 570
            |:||.|...::.:.::   :..|:..|::::..|..:|.::......|...|::|:.|..||.:.
Mouse    14 EKRKMESTAQITEEDS---KLDEVVGLQKQICDLGTELTRQSSWWCVAHKDLQSQIDALIKENQE 75

  Fly   571 YRDEIELLRKEN-------------KRLEQEL---VKI--------------------------- 592
            .|.|::.|:|::             .|....|   |||                           
Mouse    76 IRAELKTLKKQDAEATKACIGSPTPARASNTLPVYVKIEGIDSERTTSWDERDELSGSPPNRSTM 140

  Fly   593 ---GRENNSKML--------------QEINRNIARLAPKVLPSATMSDILDENGRRTQSLDGTAG 640
               |.::..:||              :.:.|:..|::|:.|..:|..|        |:||     
Mouse   141 ATGGTDSQDEMLSFTSVDEKVIHMSSKFLQRSFGRMSPEPLSDSTFLD--------TESL----- 192

  Fly   641 KPAKQREAQNRRQSSGSAQVRSRS--------------RSLSRNKKTPYALDESYASSSSVESEE 691
               ....:.|...|.|...:.:::              :::....:.|..:.::..::.:.|::|
Mouse   193 ---ADIWSSNPETSDGELLLHAQASRVIPCFSPNALWVQNIPTKSRAPKEIQQTSDTTKTDETKE 254

  Fly   692 VQPPVTAPKAATPPPAANSSSDFKREITNADGSKDIWYPNGNLKKISADGMNLRMLYFNKDIKET 756
            .:.|                 :.|.|...:||...|.:|||..|:||||.....:.:||.|:|:.
Mouse   255 KRHP-----------------NGKVERMLSDGRTIITFPNGTRKEISADKKTTLIRFFNGDMKKI 302

  Fly   757 NIREGTVKYYYAETNTWHTSYLDGLEILEFPNGQTEHRRKDGTVEIHFPNNSIKIVDPSDTEKLE 821
            . .:..|.||||:..|.||:|.||:|:::|||..||....||:.|..||:.::|.:    .:..|
Mouse   303 K-SDQKVIYYYADAQTMHTTYPDGVEVVQFPNKWTEKFYPDGSKETVFPDGTVKQL----KDGCE 362

  Fly   822 EWRYADGTHLVQLRNGDKILNLPNGQKEIHTKLNKRREYPDGTVKLVYPDGSQETRYSNGRVRLK 886
            |..:.|||.:...|||||.:...||:|||||...||:|:||||.|.||.:|.|||:|::||||:|
Mouse   363 ETVFPDGTFVTVKRNGDKTIMFSNGEKEIHTARFKRKEFPDGTTKTVYCNGCQETKYASGRVRVK 427

  Fly   887 DKDGKLIMD 895
            |:.|.:|:|
Mouse   428 DEKGTVILD 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sas-4NP_649701.2 DUF2570 <517..>587 CDD:305162 15/82 (18%)
Tcp10_C 717..895 CDD:284589 79/177 (45%)
Tcp10bNP_033367.2 DUF4527 19..>103 CDD:291689 15/86 (17%)
Tcp10_C 263..436 CDD:284589 79/177 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849708
Domainoid 1 1.000 165 1.000 Domainoid score I3892
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009891
OrthoInspector 1 1.000 - - otm43766
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10331
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.900

Return to query results.
Submit another query.