DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sas-4 and TCP10L

DIOPT Version :9

Sequence 1:NP_649701.2 Gene:Sas-4 / 40859 FlyBaseID:FBgn0011020 Length:901 Species:Drosophila melanogaster
Sequence 2:NP_653260.1 Gene:TCP10L / 140290 HGNCID:11657 Length:215 Species:Homo sapiens


Alignment Length:164 Identity:33/164 - (20%)
Similarity:72/164 - (43%) Gaps:25/164 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   528 EIAALKQEVEGLQLQLKQKEQAHVSAQARLRAQLRASEKEQRNYRDEIELLRKENKRLEQELV-- 590
            |:..|:|::..|..:|.:::........:||:.:.|..::....|:::..|:.:..:..::..  
Human    46 EMPPLQQQIIRLHQELGRQKSLWADVHGKLRSHIDALREQNMELREKLRALQLQRWKARKKSAAS 110

  Fly   591 -KIGRENNSKMLQEINRNIARLA------PKVL----PSATMSDILDENGRRTQSLDGTAGKPAK 644
             ..|:|:::..|:.....|:.|:      ||..    .|||:.      |:|:.|.:....||..
Human   111 PHAGQESHTLALEPAFGKISPLSADEETIPKYAGHKNQSATLL------GQRSSSNNSAPPKPMS 169

  Fly   645 QREAQNRRQSSGSAQVRSRSRSLSRNKK----TP 674
            .:  ..|..|..:....:|.::|||.::    ||
Human   170 LK--IERISSWKTPPQENRDKNLSRRRQDRRATP 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sas-4NP_649701.2 DUF2570 <517..>587 CDD:305162 10/58 (17%)
Tcp10_C 717..895 CDD:284589
TCP10LNP_653260.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Leucine-zipper 75..96 4/20 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..215 15/60 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159342
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.