DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and sspA

DIOPT Version :10

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_417696.1 Gene:sspA / 944744 ECOCYCID:EG10977 Length:212 Species:Escherichia coli


Alignment Length:89 Identity:23/89 - (25%)
Similarity:45/89 - (50%) Gaps:11/89 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   812 MKLYAVSDGPPSL---AVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYL 873
            |.|::   ||..:   .||:.|....:.:::.:|:   .::..::...:||.:.:|.|.|....|
E. coli    11 MTLFS---GPTDIYSHQVRIVLAEKGVSFEIEHVE---KDNPPQDLIDLNPNQSVPTLVDRELTL 69

  Fly   874 SESIAIMQYLCDKY--APDSTLYP 895
            .||..||:||.:::  .|...:||
E. coli    70 WESRIIMEYLDERFPHPPLMPVYP 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:461332
FLYWCH 162..229 CDD:461332
FLYWCH 365..432 CDD:461332
FLYWCH 597..663 CDD:461332
GstA 812..1000 CDD:440390 23/89 (26%)
sspANP_417696.1 sspA 1..211 CDD:236537 23/89 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.