| Sequence 1: | NP_001014610.1 | Gene: | gfzf / 40858 | FlyBaseID: | FBgn0250732 | Length: | 1045 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_012304.1 | Gene: | GTT1 / 854856 | SGDID: | S000001477 | Length: | 234 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 220 | Identity: | 48/220 - (21%) |
|---|---|---|---|
| Similarity: | 84/220 - (38%) | Gaps: | 56/220 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 823 SLAVRM--TLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLD----DDG--FYLSESIAI 879
Fly 880 MQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYKRTPMSLKKVQNA 944
Fly 945 LDVFE-TYLQR-----LGTKYAAGE---------------NITIADFALISATICLEAINFDL-- 986
Fly 987 ---------HQFTLVNKWYETFKVE 1002 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gfzf | NP_001014610.1 | FLYWCH | 18..87 | CDD:282369 | |
| FLYWCH | 162..229 | CDD:282369 | |||
| FLYWCH | 365..432 | CDD:282369 | |||
| FLYWCH | 597..663 | CDD:282369 | |||
| Thioredoxin_like | 811..886 | CDD:294274 | 19/70 (27%) | ||
| GstA | 812..1000 | CDD:223698 | 47/216 (22%) | ||
| GST_C_Delta_Epsilon | 900..1017 | CDD:198287 | 27/135 (20%) | ||
| GTT1 | NP_012304.1 | GST_N_GTT1_like | 6..87 | CDD:239344 | 19/72 (26%) |
| GST_C_GTT1_like | 93..218 | CDD:198298 | 28/141 (20%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||