DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and TEF4

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_012842.1 Gene:TEF4 / 853781 SGDID:S000001564 Length:412 Species:Saccharomyces cerevisiae


Alignment Length:229 Identity:53/229 - (23%)
Similarity:91/229 - (39%) Gaps:54/229 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   835 IQYQLINVDFCAMEHRSEEYSKMNPQKEIPV-LDDDGFYLSESIAIMQYLCDKYAPD---STLYP 895
            |.|..::|....:| :|.|::.:.|.|:.|. |...|..|:|::||..||.::.|.:   :.|..
Yeast    21 ISYFKLDVKIVDLE-QSSEFASLFPLKQAPAFLGPKGLKLTEALAIQFYLANQVADEKERARLLG 84

  Fly   896 QDVNVRAVI-------NQRLCFNMGFYYAPISAHSMAPIFFDYKRTPMSLKKVQNALDVFETYLQ 953
            .||..::.|       |..:..|:...:  :|...:.|  ::.|.......|:.|...||:..|:
Yeast    85 SDVIEKSQILRWASLANSDVMSNIARPF--LSFKGLIP--YNKKDVDACFVKIDNLAAVFDARLR 145

  Fly   954 RLGTKYAAGENITIAD------FALISATICLEAINFDLHQFTLVNKWYETFKVEYPQL--W--- 1007
              ...:.|.|||::.|      :|...|||             |..:|    :.::|.|  |   
Yeast   146 --DYTFVATENISLGDLHAAGSWAFGLATI-------------LGPEW----RAKHPHLMRWFNT 191

  Fly  1008 ----EIANSGMQEISAFEQ----NPPDMSHMEHP 1033
                .|..:...|:...|:    .||.....|.|
Yeast   192 VAASPIVKTPFAEVKLAEKALTYTPPKKQKAEKP 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 17/51 (33%)
GstA 812..1000 CDD:223698 43/181 (24%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 26/138 (19%)
TEF4NP_012842.1 GST_N_EF1Bgamma 4..72 CDD:239342 17/51 (33%)
GST_C_EF1Bgamma_like 89..211 CDD:198290 28/144 (19%)
EF1G 253..356 CDD:395522
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.