| Sequence 1: | NP_001014610.1 | Gene: | gfzf / 40858 | FlyBaseID: | FBgn0250732 | Length: | 1045 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_013040.1 | Gene: | GTT2 / 850666 | SGDID: | S000003983 | Length: | 233 | Species: | Saccharomyces cerevisiae |
| Alignment Length: | 202 | Identity: | 48/202 - (23%) |
|---|---|---|---|
| Similarity: | 87/202 - (43%) | Gaps: | 22/202 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 812 MKLYAVSDGPPSLAVRMTL--KALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLD-DDGFYL 873
Fly 874 SESIAIMQYLCDKYAPDSTL---YPQDVNVRAVINQRLCFNMGFYYAPISAH------SMAPIFF 929
Fly 930 DYKRTPMSLK---KVQNALDVFETYLQRLGTKYAAGENITIADFALISATICLEAINFDL-HQFT 990
Fly 991 LVNKWYE 997 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| gfzf | NP_001014610.1 | FLYWCH | 18..87 | CDD:282369 | |
| FLYWCH | 162..229 | CDD:282369 | |||
| FLYWCH | 365..432 | CDD:282369 | |||
| FLYWCH | 597..663 | CDD:282369 | |||
| Thioredoxin_like | 811..886 | CDD:294274 | 23/76 (30%) | ||
| GstA | 812..1000 | CDD:223698 | 48/202 (24%) | ||
| GST_C_Delta_Epsilon | 900..1017 | CDD:198287 | 21/108 (19%) | ||
| GTT2 | NP_013040.1 | GST_N_GTT2_like | 19..94 | CDD:239349 | 23/75 (31%) |
| GST_C_GTT2_like | 106..222 | CDD:198291 | 22/114 (19%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 1 | 1.000 | 43 | 1.000 | Domainoid score | I3172 |
| eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000035 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.810 | |||||