DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GSTF14

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_175408.1 Gene:GSTF14 / 841409 AraportID:AT1G49860 Length:254 Species:Arabidopsis thaliana


Alignment Length:189 Identity:52/189 - (27%)
Similarity:92/189 - (48%) Gaps:26/189 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   831 KALDIQYQLINVDFCAMEHRSEEY-SKMNPQKEIPVLDDDGFYLSESIAIMQYLCDKYAPDST-L 893
            |.||  ::|:.||:.|.|.:::.: |.:||..|:|||:|....|.|..||.:||.::|....| |
plant    26 KGLD--FELVFVDWLAGEAKTKTFLSTLNPFGEVPVLEDGDLKLFEPKAITRYLAEQYKDVGTNL 88

  Fly   894 YPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFF--------DYKRTPMSLKKVQNALDVFET 950
            .|.|...||:::..:..:.. .:.||::..:..:..        |......:.:|:...|:::||
plant    89 LPDDPKKRAIMSMWMEVDSN-QFLPIASTLIKELIINPYQGLATDDTAVQENKEKLSEVLNIYET 152

  Fly   951 YLQRLG-TKYAAGENITIADFALISATICLEAINFD-------LHQFTLVNKWYETFKV 1001
               ||| :.|.|||:.::||...::....|  :|.|       ::....|..|.|..|:
plant   153 ---RLGESPYLAGESFSLADLHHLAPIDYL--LNTDEEELKNLIYSRPNVAAWVEKMKM 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 22/55 (40%)
GstA 812..1000 CDD:223698 51/186 (27%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 25/118 (21%)
GSTF14NP_175408.1 GST_N_Phi 5..80 CDD:239351 22/55 (40%)
GST_C_Phi 94..214 CDD:198296 25/119 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4325
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.