DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GSTF6

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_001184893.1 Gene:GSTF6 / 839515 AraportID:AT1G02930 Length:208 Species:Arabidopsis thaliana


Alignment Length:173 Identity:43/173 - (24%)
Similarity:73/173 - (42%) Gaps:32/173 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   821 PPSLAVRMTLKAL---DIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSESIAIMQY 882
            |.|.|.|..|.||   ::.::.::|:....||:.|.:...||..::|..:|..|.:.||.||.||
plant    10 PASTATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFEDGDFKIFESRAITQY 74

  Fly   883 LCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPI----FFDYKRTPM------- 936
            :..:::....      |:.:.........||.   .|.:|...|:    .::....|:       
plant    75 IAHEFSDKGN------NLLSTGKDMAIIAMGI---EIESHEFDPVGSKLVWEQVLKPLYGMTTDK 130

  Fly   937 -----SLKKVQNALDVFETYLQRLG-TKYAAGENITIADFALI 973
                 ...|:...|||:|   .||| :||.|.::.|:.|...|
plant   131 TVVEEEEAKLAKVLDVYE---HRLGESKYLASDHFTLVDLHTI 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 22/67 (33%)
GstA 812..1000 CDD:223698 43/173 (25%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 20/91 (22%)
GSTF6NP_001184893.1 GST_N_Phi 4..77 CDD:239351 22/66 (33%)
GST_C_Phi 91..208 CDD:198296 20/86 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.