DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GSTF4

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:258 Identity:57/258 - (22%)
Similarity:95/258 - (36%) Gaps:88/258 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   815 YAVSDGPPSLAVRMTLKALD---IQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSES 876
            |.|...|.|...|..|..|.   :.|:.|.|.....||::|.:..:||..::||.:|....|.||
plant    37 YKVHGDPFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYES 101

  Fly   877 IAIMQYLCDKYAPDSTLYPQDVNVR-----AVINQRLCFNMGFYYAPISAHSMAPIFFDYKRTPM 936
            .||.||:...::...|   |.:|:|     |.:..         :..|.||.     ||...:.:
plant   102 RAITQYIAYVHSSRGT---QLLNLRSHETMATLTM---------WMEIEAHQ-----FDPPASKL 149

  Fly   937 SLKKV---------------------QNALDVFETYLQRLGTKYAAGENITIADFALISATICLE 980
            :.::|                     :..|:::|..|:.  :::.|..:.|:.            
plant   150 TWEQVIKPIYGLETDQTIVKENEAILEKVLNIYEKRLEE--SRFLACNSFTLV------------ 200

  Fly   981 AINFDLH-----QFTL-------------VNKWYETFKVEYPQLWEIANSGMQEISAFEQNPP 1025
                |||     |:.|             |.||.:  ::...:.|::|..  ||.|.|  |.|
plant   201 ----DLHHLPNIQYLLGTPTKKLFEKRSKVRKWVD--EITSREAWKMACD--QEKSWF--NKP 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 25/73 (34%)
GstA 812..1000 CDD:223698 49/231 (21%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 24/160 (15%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 24/70 (34%)
GST_C_Phi 126..243 CDD:198296 21/150 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.