DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GSTT2

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_198940.3 Gene:GSTT2 / 834125 AraportID:AT5G41240 Length:591 Species:Arabidopsis thaliana


Alignment Length:216 Identity:57/216 - (26%)
Similarity:98/216 - (45%) Gaps:21/216 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   812 MKLYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSES 876
            :|:||.....||.||.:..|..:||:..|.:.....:..|.|:.::||..::|.:.|....|.||
plant     3 LKVYADRMSQPSRAVLIFCKVNEIQFDEILISLGKRQQLSPEFKEINPMGKVPAIVDGRLKLFES 67

  Fly   877 IAIMQYLCDKYAPDSTL---YPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYKRTPMSL 938
            .||:.||...||  |.:   ||.|::.||.|:..|.::........|.:.:..:.......|::.
plant    68 HAILIYLSSAYA--SVVDHWYPNDLSKRAKIHSVLDWHHTNLRPGASGYVLNSVLAPALGLPLNP 130

  Fly   939 KK-------VQNALDVFETYLQRLGTKY-AAGENITIADFALISATICLEAINFDLHQFTL---- 991
            |.       :.|:|...||:..:...|: ..|:..:|||.:|:...:.|:.:: |..:..|    
plant   131 KAAAEAENILTNSLSTLETFWLKGSAKFLLGGKQPSIADLSLVCELMQLQVLD-DKDRLRLLSPH 194

  Fly   992 --VNKWYE-TFKVEYPQLWEI 1009
              |.:|.| |.|...|...|:
plant   195 KKVEQWIESTRKATMPHSDEV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 24/73 (33%)
GstA 812..1000 CDD:223698 54/205 (26%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 27/125 (22%)
GSTT2NP_198940.3 GST_N_Theta 3..78 CDD:239348 24/74 (32%)
GST_C_Theta 92..221 CDD:198292 27/125 (22%)
NAM-associated 380..>515 CDD:405060
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.