DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GSTT3

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_198938.1 Gene:GSTT3 / 834124 AraportID:AT5G41220 Length:590 Species:Arabidopsis thaliana


Alignment Length:215 Identity:55/215 - (25%)
Similarity:92/215 - (42%) Gaps:19/215 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   812 MKLYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSES 876
            :|:||.....||.||.:..|..:||:..|.:.....:..|.|:..:||..::|.:.|....||||
plant     3 LKVYADRMSQPSRAVLIFCKVNEIQFDEILIYLANRQQLSPEFKDINPMGKVPAIVDGKLKLSES 67

  Fly   877 IAIMQYLCDKYAPD--STLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYKRTPMSLK 939
            .||:.||...| |.  ...||.|::.||.|:..|.::........:.:.:..:.......|::.|
plant    68 HAILIYLSSAY-PSVVDHWYPTDLSKRARIHSVLDWHHTNLRPGAAGYVLNSVLGPALGLPLNPK 131

  Fly   940 KVQNA-------LDVFETYLQRLGTKYAAGEN-ITIADFALISATICLEAINFDLHQFTL----- 991
            ....|       |...:|:..:....:..|.| .:|||.:|:.....|:.:: |..:..|     
plant   132 AAAEAEQLLTKSLTTLDTFWLKGNAMFLLGSNQPSIADLSLVCELTQLQVLD-DKDRLRLLSPHK 195

  Fly   992 -VNKWYE-TFKVEYPQLWEI 1009
             |.:|.| |.|...|...|:
plant   196 NVEQWIENTRKATMPHFDEV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 25/73 (34%)
GstA 812..1000 CDD:223698 52/204 (25%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 25/125 (20%)
GSTT3NP_198938.1 PLN02473 1..202 CDD:166114 50/200 (25%)
GST_N_Theta 3..78 CDD:239348 25/74 (34%)
GST_C_Theta 92..221 CDD:198292 25/125 (20%)
NAM-associated 378..>455 CDD:291001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.