DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GSTF12

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_197224.1 Gene:GSTF12 / 831586 AraportID:AT5G17220 Length:214 Species:Arabidopsis thaliana


Alignment Length:206 Identity:55/206 - (26%)
Similarity:95/206 - (46%) Gaps:31/206 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   812 MKLYA-VSDGPPSLAVRMTLKALD--IQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYL 873
            :|||. |:...|.   |:.|..|:  |::::|::|....|.:..|:....|..::|.::|..|.|
plant     3 VKLYGQVTAACPQ---RVLLCFLEKGIEFEIIHIDLDTFEQKKPEHLLRQPFGQVPAIEDGDFKL 64

  Fly   874 SESIAIMQYLCDKYAPDST-LYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYKRTPM- 936
            .||.||.:|...|:|...| |..:.:..||:::|  ..::..||..:.|.   |:..:....|. 
plant    65 FESRAIARYYATKFADQGTNLLGKSLEHRAIVDQ--WADVETYYFNVLAQ---PLVINLIIKPRL 124

  Fly   937 ----------SLK-KVQNALDVFETYLQRLGTKYAAGENITIADFALISATICLEAINFDLHQFT 990
                      .|| |:...||::...|.  ..::.|||..|:||...:.|...|.:|. |::|..
plant   125 GEKCDVVLVEDLKVKLGVVLDIYNNRLS--SNRFLAGEEFTMADLTHMPAMGYLMSIT-DINQMV 186

  Fly   991 LV----NKWYE 997
            ..    |:|:|
plant   187 KARGSFNRWWE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 23/76 (30%)
GstA 812..1000 CDD:223698 55/206 (27%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 28/114 (25%)
GSTF12NP_197224.1 PLN02473 1..214 CDD:166114 55/206 (27%)
GST_N_Phi 2..77 CDD:239351 23/76 (30%)
GST_C_Phi 91..209 CDD:198296 28/115 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.