DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GSTF2

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_192161.1 Gene:GSTF2 / 827931 AraportID:AT4G02520 Length:212 Species:Arabidopsis thaliana


Alignment Length:209 Identity:54/209 - (25%)
Similarity:81/209 - (38%) Gaps:54/209 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   821 PPSLAVRMTLKAL---DIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSESIAIMQY 882
            |.|:|.|..|.||   ::.::|::|:....||:.|.:...||..::|..:|....|.||.||.||
plant    10 PASIATRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQY 74

  Fly   883 LCDKYAPDST--LYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPI-----FFDYKRTPMSL-- 938
            :..:|....|  |.....|    |:|.....:|.   .:..|...|:     |....::...|  
plant    75 IAHRYENQGTNLLQTDSKN----ISQYAIMAIGM---QVEDHQFDPVASKLAFEQIFKSIYGLTT 132

  Fly   939 ---------KKVQNALDVFETYLQRLGTKYAAGENITIADFALISATICLEAINFDLHQFTL--- 991
                     .|:...|||:|..|:..  ||.|||..|:.|...|.|.           |:.|   
plant   133 DEAVVAEEEAKLAKVLDVYEARLKEF--KYLAGETFTLTDLHHIPAI-----------QYLLGTP 184

  Fly   992 ----------VNKW 995
                      ||:|
plant   185 TKKLFTERPRVNEW 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 23/67 (34%)
GstA 812..1000 CDD:223698 54/209 (26%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 27/125 (22%)
GSTF2NP_192161.1 GST_N_Phi 4..78 CDD:239351 23/67 (34%)
GST_C_Phi 96..211 CDD:198296 26/119 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.