DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GSTF11

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_186969.1 Gene:GSTF11 / 821227 AraportID:AT3G03190 Length:214 Species:Arabidopsis thaliana


Alignment Length:197 Identity:47/197 - (23%)
Similarity:89/197 - (45%) Gaps:29/197 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   834 DIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSESIAIMQYLCDKYAPDST-LYPQD 897
            ||::::|:||...:|.:..::....|..::|.::|....|.||.||.:|...|||...| |..:.
plant    25 DIEFEVIHVDLDKLEQKKPQHLLRQPFGQVPAIEDGYLKLFESRAIARYYATKYADQGTDLLGKT 89

  Fly   898 VNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYKRTPMSLK-------KVQNALDVFETYLQRL 955
            :..||:::|.:.....::||......|..:|......|..:.       |....|||:|   .||
plant    90 LEGRAIVDQWVEVENNYFYAVALPLVMNVVFKPKSGKPCDVALVEELKVKFDKVLDVYE---NRL 151

  Fly   956 GT-KYAAGENITIADFALISATICLEAINFDLHQFTL---------VNKWYETFKVE--YPQLWE 1008
            .| :|..|:..|:||.:      .:..:.:.:::.:|         :|:|:......  :.:|.|
plant   152 ATNRYLGGDEFTLADLS------HMPGMRYIMNETSLSGLVTSRENLNRWWNEISARPAWKKLME 210

  Fly  1009 IA 1010
            :|
plant   211 LA 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 15/51 (29%)
GstA 812..1000 CDD:223698 44/183 (24%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 27/130 (21%)
GSTF11NP_186969.1 PLN02473 1..214 CDD:166114 47/197 (24%)
GST_N_Phi 2..77 CDD:239351 15/51 (29%)
GST_C_Phi 91..209 CDD:198296 24/126 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.