DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GSTF8

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_001323480.1 Gene:GSTF8 / 819386 AraportID:AT2G47730 Length:263 Species:Arabidopsis thaliana


Alignment Length:221 Identity:65/221 - (29%)
Similarity:107/221 - (48%) Gaps:23/221 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   802 SYGSIVPIYTMKLYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVL 866
            |..|.:.:.::|::.|.....::.|..||...|:|::||.||..|..|:.|.:..:||..:||.|
plant    42 SSSSSIIMASIKVHGVPMSTATMRVLATLYEKDLQFELIPVDMRAGAHKQEAHLALNPFGQIPAL 106

  Fly   867 DDDGFYLSESIAIMQYLCDKYA-PDSTLYPQDV-NVRAVINQRLCFNMGFYYAPISAHSMA--PI 927
            :|....|.||.||.|||.::|: ....|..||. .|:|..|..|... |..:.| :|..:|  .:
plant   107 EDGDLTLFESRAITQYLAEEYSEKGEKLISQDCKKVKATTNVWLQVE-GQQFDP-NASKLAFERV 169

  Fly   928 F---FDYKRTPMSLK----KVQNALDVFETYLQRLGTKYAAGENITIADFALISATICL----EA 981
            |   |.....|.:::    |:|..|||:|..|.:  :::.||::.|:||...:.|...|    ..
plant   170 FKGMFGMTTDPAAVQELEGKLQKVLDVYEARLAK--SEFLAGDSFTLADLHHLPAIHYLLGTDSK 232

  Fly   982 INFDLHQFTLVNKWYETFKVEYPQLW 1007
            :.||..  ..|::|.:  |:.....|
plant   233 VLFDSR--PKVSEWIK--KISARPAW 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 28/74 (38%)
GstA 812..1000 CDD:223698 61/202 (30%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 31/121 (26%)
GSTF8NP_001323480.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4325
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.