DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GSTF10

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_180644.1 Gene:GSTF10 / 817637 AraportID:AT2G30870 Length:215 Species:Arabidopsis thaliana


Alignment Length:225 Identity:63/225 - (28%)
Similarity:101/225 - (44%) Gaps:35/225 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   812 MKLYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSES 876
            :.:||........|| :||....:.::.:|||....|.|..||..:.|..:||||.|..:.:.||
plant     3 LTIYAPLFASSKRAV-VTLVEKGVSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFES 66

  Fly   877 IAIMQYLCDKY---APDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIF-------FDY 931
            .|||:|:.:||   .||  |..:.:..|..:.|.|......|:.|:.|.::..:|       .|.
plant    67 RAIMRYIAEKYRSQGPD--LLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFAPLMGFPADE 129

  Fly   932 KRTPMSLKKVQNALDVFETYLQRLGTKYAAGENITIADFALISATICL-------EAINFDLHQF 989
            |....|.:|:...|||:|..|.:  .:|.||:.:::||.|.:..|..|       ..|....|  
plant   130 KVIKESEEKLAEVLDVYEAQLSK--NEYLAGDFVSLADLAHLPFTEYLVGPIGKAHLIKDRKH-- 190

  Fly   990 TLVNKWYETFKVEYPQLWEIANSGMQEISA 1019
              |:.|::  |:.....|       :|:||
plant   191 --VSAWWD--KISSRAAW-------KEVSA 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 25/73 (34%)
GstA 812..1000 CDD:223698 58/204 (28%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 30/130 (23%)
GSTF10NP_180644.1 PLN02395 1..215 CDD:166036 63/225 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4325
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.