DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GSTF3

DIOPT Version :10

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_178394.1 Gene:GSTF3 / 814822 AraportID:AT2G02930 Length:212 Species:Arabidopsis thaliana


Alignment Length:169 Identity:49/169 - (28%)
Similarity:75/169 - (44%) Gaps:28/169 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   821 PPSLAVRMTLKAL---DIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSESIAIMQY 882
            |.|.:.|..|.||   ::.::|::|:....||:.|.:...||..::|..:|....|.||.||.||
plant    10 PASTSTRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFESRAITQY 74

  Fly   883 LCDKYAPDST-LYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIF----------FDY-KRTP 935
            :..:|....| |.|.|   ...|.|....::|.   .:.||...|:.          |:| ..|.
plant    75 IAHRYENQGTNLLPAD---SKNIAQYAIMSIGI---QVEAHQFDPVASKLAWEQVFKFNYGLNTD 133

  Fly   936 MSL-----KKVQNALDVFETYLQRLGTKYAAGENITIAD 969
            .::     .|:...|||:|..|:..  ||.|||..|:.|
plant   134 QAVVAEEEAKLAKVLDVYEARLKEF--KYLAGETFTLTD 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:461332
FLYWCH 162..229 CDD:461332
FLYWCH 365..432 CDD:461332
FLYWCH 597..663 CDD:461332
GstA 812..1000 CDD:440390 49/169 (29%)
GSTF3NP_178394.1 GST_N_Phi 4..78 CDD:239351 22/67 (33%)
GST_C_Phi 96..212 CDD:198296 21/80 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.