DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and Eef1e1

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_079656.1 Gene:Eef1e1 / 66143 MGIID:1913393 Length:174 Species:Mus musculus


Alignment Length:167 Identity:40/167 - (23%)
Similarity:64/167 - (38%) Gaps:45/167 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   853 EYSKMNPQKEIPVLD-DDGFYLSESIAIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYY 916
            :||... :::||||. ::|..|.....|..:|. |.|....|.......:|::.|.|.|.:    
Mouse    21 KYSAQG-ERQIPVLQTNNGPSLMGLSTIATHLV-KQASKEHLLGSTAEEKAMVQQWLEFRV---- 79

  Fly   917 APISAHSMAPIFFDYKRTPMSLKKVQNALDVFETYLQRLGTKYAAGENITIADFALISATICLEA 981
            ..:..||             |.:..|..|....:||:  ...|.||.|||:||..|.        
Mouse    80 TRVDGHS-------------SKEDTQTLLKDLNSYLE--DKVYLAGHNITLADILLY-------- 121

  Fly   982 INFDLHQFTL------------VNKWYETFKVEYPQL 1006
              :.||:|.:            |::|:...: .||.:
Mouse   122 --YGLHRFIVDLTVQEKEKYLNVSRWFCHIQ-HYPDI 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 10/33 (30%)
GstA 812..1000 CDD:223698 38/159 (24%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 27/119 (23%)
Eef1e1NP_079656.1 N-terminal. /evidence=ECO:0000250 2..56 11/36 (31%)
Linker. /evidence=ECO:0000250 57..63 1/5 (20%)
C-terminal. /evidence=ECO:0000250 64..152 25/117 (21%)
GST_C_AIMP3 65..165 CDD:198338 27/121 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.