DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and gstt1-like.2

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:XP_031748213.1 Gene:gstt1-like.2 / 496693 XenbaseID:XB-GENE-980731 Length:245 Species:Xenopus tropicalis


Alignment Length:256 Identity:55/256 - (21%)
Similarity:102/256 - (39%) Gaps:68/256 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   812 MKLYAVSDGPPSLAVRMTLKALDIQYQLINVDFC------AMEHRSEEYSKMNPQKEIPVLDDDG 870
            :.||......|..:|.:..||..|.:     ::|      |.||.::|:.|::...::|.|.|..
 Frog     6 LTLYLDLLSQPCRSVYIFAKANRIPF-----NYCKLQLLKAGEHLTQEFGKVSVLHKVPALKDGN 65

  Fly   871 FYLSESIAIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYKRTP 935
            |.::||.|::.||..||...:..||.|:..||.:::.|.:.    :.....|. :.:|:....:|
 Frog    66 FTMAESTAMLLYLARKYKTPNHWYPSDLQKRARVDEYLAWQ----HTNTRPHG-SKVFWTKCVSP 125

  Fly   936 MSL------KKVQNALDVFETYLQR-----LGTK-YAAGENITIADFALISATI----------- 977
            ..|      :|:...:..|.|.:..     ||.| :.||:.|::||...|...:           
 Frog   126 TILGKEVPSEKMNAVMAEFVTTMNNFEEKFLGNKPFIAGDEISVADLVAIVEIMQVIASGVNVFE 190

  Fly   978 -----------CLEAINFDLHQFTLVNKWYETFKVEYPQLWEIANSGMQEISAFEQNPPDM 1027
                       .:||:..:|  |...::|..:|..:                .|:..||::
 Frog   191 ERPKLGSWKQRLVEAVGEEL--FLEAHEWILSFSKQ----------------KFDPPPPEL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 22/79 (28%)
GstA 812..1000 CDD:223698 51/227 (22%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 25/150 (17%)
gstt1-like.2XP_031748213.1 GST_N_Theta 6..82 CDD:239348 22/80 (28%)
GST_C_Theta 95..221 CDD:198292 24/132 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.