DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GstD7

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster


Alignment Length:222 Identity:79/222 - (35%)
Similarity:114/222 - (51%) Gaps:22/222 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   812 MKLYAVSDGPPSLAVRMTLKA--LDIQYQLINVDFCAME--HRSEEYSKMNPQKEIPVLDDDGFY 872
            :.||.....|.|.|::|..||  |::..:|||    .||  ....|:.::|||..||.|.|:||.
  Fly     4 LDLYNFPMAPASRAIQMVAKALGLELNSKLIN----TMEGDQLKPEFVRINPQHTIPTLVDNGFV 64

  Fly   873 LSESIAIMQYLCDKYA-PDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYKRT-- 934
            :.||.||..||.:||. |||.|||.|...||:|||||.|:||..|..::.:     ||...||  
  Fly    65 IWESRAIAVYLVEKYGKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKY-----FFLIFRTGK 124

  Fly   935 ---PMSLKKVQNALDVFETYLQRLGTKYAAGENITIADFALISATICLEAINFDLHQFTLVNKWY 996
               ..:|.||.:|.....|:|:  |..:.||..:|:||..:::....:|..:|||.:|..|.:|.
  Fly   125 FGDQEALDKVNSAFGFLNTFLE--GQDFVAGSQLTVADIVILATVSTVEWFSFDLSKFPNVERWL 187

  Fly   997 ETFKVEYPQLWEIANSGMQEISAFEQN 1023
            :......|. ||.....:|:...|.|:
  Fly   188 KNAPKVTPG-WEQNLESLQQGKKFLQD 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 30/77 (39%)
GstA 812..1000 CDD:223698 73/197 (37%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 38/121 (31%)
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 30/76 (39%)
GstA 6..188 CDD:223698 73/192 (38%)
GST_C_Delta_Epsilon 92..206 CDD:198287 37/121 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.920

Return to query results.
Submit another query.