DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GstD5

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_524914.3 Gene:GstD5 / 48338 FlyBaseID:FBgn0010041 Length:216 Species:Drosophila melanogaster


Alignment Length:209 Identity:71/209 - (33%)
Similarity:110/209 - (52%) Gaps:9/209 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   812 MKLYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSES 876
            |..|....|.....|.|..|||.::..:..::....:....|:.|:|||..||.|.|:||.:.||
  Fly     1 MDFYYSPRGSGCRTVIMVAKALGVKLNMKLLNTLEKDQLKPEFVKLNPQHTIPTLVDNGFSIWES 65

  Fly   877 IAIMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYKRTPMS---L 938
            .||..||.:||..|.||:|:|...:|::||||.|:||..|...:.: ..|:|...|  |.|   .
  Fly    66 RAIAVYLVEKYGKDDTLFPKDPKKQALVNQRLYFDMGTLYDSFAKY-YYPLFHTGK--PGSDEDF 127

  Fly   939 KKVQNALDVFETYLQRLGTKYAAGENITIADFALISATICLEAINFDLHQFTLVNKWYETFKVEY 1003
            ||::::.:....:|:  |..|.||:::|:||.|::|.....|..:|||:::..|.:||...|...
  Fly   128 KKIESSFEYLNIFLE--GQNYVAGDHLTVADIAILSTVSTFEIFDFDLNKYPNVARWYANAKKVT 190

  Fly  1004 PQLWEIANSGMQEI 1017
            |. ||....|..|:
  Fly   191 PG-WEENWKGAVEL 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 25/73 (34%)
GstA 812..1000 CDD:223698 65/190 (34%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 38/119 (32%)
GstD5NP_524914.3 GstA 1..184 CDD:223698 64/187 (34%)
GST_N_Delta_Epsilon 1..74 CDD:239343 25/72 (35%)
GST_C_Delta_Epsilon 88..204 CDD:198287 39/122 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.920

Return to query results.
Submit another query.