DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gfzf and GstD11

DIOPT Version :9

Sequence 1:NP_001014610.1 Gene:gfzf / 40858 FlyBaseID:FBgn0250732 Length:1045 Species:Drosophila melanogaster
Sequence 2:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster


Alignment Length:198 Identity:60/198 - (30%)
Similarity:100/198 - (50%) Gaps:7/198 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   814 LYAVSDGPPSLAVRMTLKALDIQYQLINVDFCAMEHRSEEYSKMNPQKEIPVLDDDGFYLSESIA 878
            ||.:...||..::.:..|.|||.::|..|:....|....::..||||..:|.::|:|..|.||.|
  Fly    27 LYYLPPSPPCRSILLLAKMLDIDFELKIVNILEGEQLKPDFVAMNPQHCVPTMNDEGLVLWESRA 91

  Fly   879 IMQYLCDKYAPDSTLYPQDVNVRAVINQRLCFNMGFYYAPISAHSMAPIFFDYKRTPMSLKKVQN 943
            |:.||...|.....|||.|:.|||:::|||.|::|..|..::.:....:|...........|:..
  Fly    92 ILSYLVAAYGKSDQLYPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIGAPLDEGKRAKLAE 156

  Fly   944 ALDVFETYLQRLGTKYAAGENITIADFALISATICLEAINFDLHQFTLVNKWYETFK-----VEY 1003
            |:....|.|:  |.:::|.::.||||..|:.....|||..|:|..:..:.:|.:..|     .:|
  Fly   157 AVGWLNTILE--GRQFSAADHFTIADLTLLVTVSQLEAFEFELRPYKHIRQWLDRCKDHMAPFDY 219

  Fly  1004 PQL 1006
            .:|
  Fly   220 EEL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gfzfNP_001014610.1 FLYWCH 18..87 CDD:282369
FLYWCH 162..229 CDD:282369
FLYWCH 365..432 CDD:282369
FLYWCH 597..663 CDD:282369
Thioredoxin_like 811..886 CDD:294274 25/71 (35%)
GstA 812..1000 CDD:223698 57/185 (31%)
GST_C_Delta_Epsilon 900..1017 CDD:198287 30/112 (27%)
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 25/70 (36%)
GST_C_Delta_Epsilon 112..231 CDD:198287 30/113 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm975
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR43969
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.920

Return to query results.
Submit another query.